EDN3 purified MaxPab rabbit polyclonal antibody (D01P)
  • EDN3 purified MaxPab rabbit polyclonal antibody (D01P)

EDN3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001908-D01P
EDN3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EDN3 protein.
Información adicional
Size 100 ug
Gene Name EDN3
Gene Alias ET3|MGC15067|MGC61498
Gene Description endothelin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EDN3 (NP_000105.1, 1 a.a. ~ 238 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1908

Enviar uma mensagem


EDN3 purified MaxPab rabbit polyclonal antibody (D01P)

EDN3 purified MaxPab rabbit polyclonal antibody (D01P)