EDN3 polyclonal antibody (A01)
  • EDN3 polyclonal antibody (A01)

EDN3 polyclonal antibody (A01)

Ref: AB-H00001908-A01
EDN3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant EDN3.
Información adicional
Size 50 uL
Gene Name EDN3
Gene Alias ET3|MGC15067|MGC61498
Gene Description endothelin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDN3 (AAH08876, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1908

Enviar uma mensagem


EDN3 polyclonal antibody (A01)

EDN3 polyclonal antibody (A01)