EDG3 monoclonal antibody (M02), clone 2G11
  • EDG3 monoclonal antibody (M02), clone 2G11

EDG3 monoclonal antibody (M02), clone 2G11

Ref: AB-H00001903-M02
EDG3 monoclonal antibody (M02), clone 2G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EDG3.
Información adicional
Size 100 ug
Gene Name S1PR3
Gene Alias EDG-3|EDG3|FLJ37523|FLJ93220|LPB3|MGC71696|S1P3
Gene Description sphingosine-1-phosphate receptor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDG3 (NP_005217.2, 302 a.a. ~ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1903
Clone Number 2G11
Iso type IgG1 Kappa

Enviar uma mensagem


EDG3 monoclonal antibody (M02), clone 2G11

EDG3 monoclonal antibody (M02), clone 2G11