EBF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • EBF1 purified MaxPab rabbit polyclonal antibody (D01P)

EBF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001879-D01P
EBF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EBF1 protein.
Información adicional
Size 100 ug
Gene Name EBF1
Gene Alias COE1|EBF|FLJ39389|FLJ41763|O/E-1|OLF1
Gene Description early B-cell factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGDN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EBF1 (AAH41178.1, 1 a.a. ~ 560 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1879

Enviar uma mensagem


EBF1 purified MaxPab rabbit polyclonal antibody (D01P)

EBF1 purified MaxPab rabbit polyclonal antibody (D01P)