E2F4 monoclonal antibody (M01), clone 5B7
  • E2F4 monoclonal antibody (M01), clone 5B7

E2F4 monoclonal antibody (M01), clone 5B7

Ref: AB-H00001874-M01
E2F4 monoclonal antibody (M01), clone 5B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant E2F4.
Información adicional
Size 100 ug
Gene Name E2F4
Gene Alias E2F-4
Gene Description E2F transcription factor 4, p107/p130-binding
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen E2F4 (NP_001941, 211 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1874
Clone Number 5B7
Iso type IgG1 Kappa

Enviar uma mensagem


E2F4 monoclonal antibody (M01), clone 5B7

E2F4 monoclonal antibody (M01), clone 5B7