E2F4 purified MaxPab rabbit polyclonal antibody (D01P)
  • E2F4 purified MaxPab rabbit polyclonal antibody (D01P)

E2F4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001874-D01P
E2F4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human E2F4 protein.
Información adicional
Size 100 ug
Gene Name E2F4
Gene Alias E2F-4
Gene Description E2F transcription factor 4, p107/p130-binding
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIELKAEIEELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHEDICRCFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQIHLKSVSGPIEVLLVNKEAWSSPPVAVPVPPPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen E2F4 (NP_001941.2, 1 a.a. ~ 413 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1874

Enviar uma mensagem


E2F4 purified MaxPab rabbit polyclonal antibody (D01P)

E2F4 purified MaxPab rabbit polyclonal antibody (D01P)