E2F3 monoclonal antibody (M04), clone 3C11
  • E2F3 monoclonal antibody (M04), clone 3C11

E2F3 monoclonal antibody (M04), clone 3C11

Ref: AB-H00001871-M04
E2F3 monoclonal antibody (M04), clone 3C11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant E2F3.
Información adicional
Size 100 ug
Gene Name E2F3
Gene Alias DKFZp686C18211|E2F-3|KIAA0075|MGC104598
Gene Description E2F transcription factor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen E2F3 (AAH16847.1, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1871
Clone Number 3C11
Iso type IgG2b Kappa

Enviar uma mensagem


E2F3 monoclonal antibody (M04), clone 3C11

E2F3 monoclonal antibody (M04), clone 3C11