E2F2 polyclonal antibody (A01)
  • E2F2 polyclonal antibody (A01)

E2F2 polyclonal antibody (A01)

Ref: AB-H00001870-A01
E2F2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant E2F2.
Información adicional
Size 50 uL
Gene Name E2F2
Gene Alias E2F-2
Gene Description E2F transcription factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen E2F2 (NP_004082, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1870

Enviar uma mensagem


E2F2 polyclonal antibody (A01)

E2F2 polyclonal antibody (A01)