DVL3 MaxPab rabbit polyclonal antibody (D01)
  • DVL3 MaxPab rabbit polyclonal antibody (D01)

DVL3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001857-D01
DVL3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DVL3 protein.
Información adicional
Size 100 uL
Gene Name DVL3
Gene Alias KIAA0208
Gene Description dishevelled, dsh homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNME
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DVL3 (AAH32459.1, 1 a.a. ~ 716 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1857

Enviar uma mensagem


DVL3 MaxPab rabbit polyclonal antibody (D01)

DVL3 MaxPab rabbit polyclonal antibody (D01)