DUT monoclonal antibody (M01), clone 1C9
  • DUT monoclonal antibody (M01), clone 1C9

DUT monoclonal antibody (M01), clone 1C9

Ref: AB-H00001854-M01
DUT monoclonal antibody (M01), clone 1C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DUT.
Información adicional
Size 100 ug
Gene Name DUT
Gene Alias FLJ20622|dUTPase
Gene Description deoxyuridine triphosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq TDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUT (AAH33645, 68 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1854
Clone Number 1C9
Iso type IgG1 Kappa

Enviar uma mensagem


DUT monoclonal antibody (M01), clone 1C9

DUT monoclonal antibody (M01), clone 1C9