DUT purified MaxPab rabbit polyclonal antibody (D01P)
  • DUT purified MaxPab rabbit polyclonal antibody (D01P)

DUT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001854-D01P
DUT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DUT protein.
Información adicional
Size 100 ug
Gene Name DUT
Gene Alias FLJ20622|dUTPase
Gene Description deoxyuridine triphosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DUT (NP_001020419.1, 1 a.a. ~ 252 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1854

Enviar uma mensagem


DUT purified MaxPab rabbit polyclonal antibody (D01P)

DUT purified MaxPab rabbit polyclonal antibody (D01P)