DUSP9 purified MaxPab rabbit polyclonal antibody (D01P)
  • DUSP9 purified MaxPab rabbit polyclonal antibody (D01P)

DUSP9 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001852-D01P
DUSP9 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DUSP9 protein.
Información adicional
Size 100 ug
Gene Name DUSP9
Gene Alias MKP-4|MKP4
Gene Description dual specificity phosphatase 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLSVRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLAYYLQGGFSRFQAECPHLCETSLAGRAGSSMAPLPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DUSP9 (AAH60837.1, 1 a.a. ~ 384 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1852

Enviar uma mensagem


DUSP9 purified MaxPab rabbit polyclonal antibody (D01P)

DUSP9 purified MaxPab rabbit polyclonal antibody (D01P)