DUSP5 monoclonal antibody (M03), clone 4C8
  • DUSP5 monoclonal antibody (M03), clone 4C8

DUSP5 monoclonal antibody (M03), clone 4C8

Ref: AB-H00001847-M03
DUSP5 monoclonal antibody (M03), clone 4C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DUSP5.
Información adicional
Size 100 ug
Gene Name DUSP5
Gene Alias DUSP|HVH3
Gene Description dual specificity phosphatase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1847
Clone Number 4C8
Iso type IgG1 Kappa

Enviar uma mensagem


DUSP5 monoclonal antibody (M03), clone 4C8

DUSP5 monoclonal antibody (M03), clone 4C8