DUSP5 monoclonal antibody (M02A), clone 3D8
  • DUSP5 monoclonal antibody (M02A), clone 3D8

DUSP5 monoclonal antibody (M02A), clone 3D8

Ref: AB-H00001847-M02A
DUSP5 monoclonal antibody (M02A), clone 3D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DUSP5.
Información adicional
Size 200 uL
Gene Name DUSP5
Gene Alias DUSP|HVH3
Gene Description dual specificity phosphatase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1847
Clone Number 3D8
Iso type IgG1 Kappa

Enviar uma mensagem


DUSP5 monoclonal antibody (M02A), clone 3D8

DUSP5 monoclonal antibody (M02A), clone 3D8