DUSP5 polyclonal antibody (A01)
  • DUSP5 polyclonal antibody (A01)

DUSP5 polyclonal antibody (A01)

Ref: AB-H00001847-A01
DUSP5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DUSP5.
Información adicional
Size 50 uL
Gene Name DUSP5
Gene Alias DUSP|HVH3
Gene Description dual specificity phosphatase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1847

Enviar uma mensagem


DUSP5 polyclonal antibody (A01)

DUSP5 polyclonal antibody (A01)