DUSP3 monoclonal antibody (M01), clone 5B7
  • DUSP3 monoclonal antibody (M01), clone 5B7

DUSP3 monoclonal antibody (M01), clone 5B7

Ref: AB-H00001845-M01
DUSP3 monoclonal antibody (M01), clone 5B7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant DUSP3.
Información adicional
Size 50 ug
Gene Name DUSP3
Gene Alias VHR
Gene Description dual specificity phosphatase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP3 (AAH02682, 1 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1845
Clone Number 5B7
Iso type IgG2a Kappa

Enviar uma mensagem


DUSP3 monoclonal antibody (M01), clone 5B7

DUSP3 monoclonal antibody (M01), clone 5B7