DUSP1 polyclonal antibody (A01)
  • DUSP1 polyclonal antibody (A01)

DUSP1 polyclonal antibody (A01)

Ref: AB-H00001843-A01
DUSP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DUSP1.
Información adicional
Size 50 uL
Gene Name DUSP1
Gene Alias CL100|HVH1|MKP-1|MKP1|PTPN10
Gene Description dual specificity phosphatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP1 (NP_004408, 305 a.a. ~ 367 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1843

Enviar uma mensagem


DUSP1 polyclonal antibody (A01)

DUSP1 polyclonal antibody (A01)