DTNB polyclonal antibody (A01)
  • DTNB polyclonal antibody (A01)

DTNB polyclonal antibody (A01)

Ref: AB-H00001838-A01
DTNB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DTNB.
Información adicional
Size 50 uL
Gene Name DTNB
Gene Alias MGC17163|MGC57126
Gene Description dystrobrevin, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DTNB (NP_899205, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1838

Enviar uma mensagem


DTNB polyclonal antibody (A01)

DTNB polyclonal antibody (A01)