SLC26A2 monoclonal antibody (M04), clone 3F6
  • SLC26A2 monoclonal antibody (M04), clone 3F6

SLC26A2 monoclonal antibody (M04), clone 3F6

Ref: AB-H00001836-M04
SLC26A2 monoclonal antibody (M04), clone 3F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC26A2.
Información adicional
Size 100 ug
Gene Name SLC26A2
Gene Alias D5S1708|DTD|DTDST|EDM4|MST153|MSTP157
Gene Description solute carrier family 26 (sulfate transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC26A2 (NP_000103.1, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1836
Clone Number 3F6
Iso type IgG2b Kappa

Enviar uma mensagem


SLC26A2 monoclonal antibody (M04), clone 3F6

SLC26A2 monoclonal antibody (M04), clone 3F6