DSG1 purified MaxPab rabbit polyclonal antibody (D01P)
  • DSG1 purified MaxPab rabbit polyclonal antibody (D01P)

DSG1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001828-D01P
DSG1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DSG1 protein.
Información adicional
Size 100 ug
Gene Name DSG1
Gene Alias CDHF4|DG1|DSG
Gene Description desmoglein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECEC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DSG1 (AAI53002.1, 1 a.a. ~ 1049 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1828

Enviar uma mensagem


DSG1 purified MaxPab rabbit polyclonal antibody (D01P)

DSG1 purified MaxPab rabbit polyclonal antibody (D01P)