DSCAM polyclonal antibody (A01)
  • DSCAM polyclonal antibody (A01)

DSCAM polyclonal antibody (A01)

Ref: AB-H00001826-A01
DSCAM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DSCAM.
Información adicional
Size 50 uL
Gene Name DSCAM
Gene Alias CHD2-42|CHD2-52
Gene Description Down syndrome cell adhesion molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DSCAM (NP_001380, 184 a.a. ~ 271 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1826

Enviar uma mensagem


DSCAM polyclonal antibody (A01)

DSCAM polyclonal antibody (A01)