DSC2 purified MaxPab rabbit polyclonal antibody (D01P)
  • DSC2 purified MaxPab rabbit polyclonal antibody (D01P)

DSC2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001824-D01P
DSC2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DSC2 protein.
Información adicional
Size 100 ug
Gene Name DSC2
Gene Alias ARVD11|CDHF2|DG2|DGII/III|DKFZp686I11137|DSC3
Gene Description desmocollin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DSC2 (NP_004940.1, 1 a.a. ~ 847 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1824

Enviar uma mensagem


DSC2 purified MaxPab rabbit polyclonal antibody (D01P)

DSC2 purified MaxPab rabbit polyclonal antibody (D01P)