DPT monoclonal antibody (M08), clone 2A11
  • DPT monoclonal antibody (M08), clone 2A11

DPT monoclonal antibody (M08), clone 2A11

Ref: AB-H00001805-M08
DPT monoclonal antibody (M08), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPT.
Información adicional
Size 100 ug
Gene Name DPT
Gene Alias TRAMP
Gene Description dermatopontin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq EWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPT (NP_001928.2, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1805
Clone Number 2A11
Iso type IgG2a Kappa

Enviar uma mensagem


DPT monoclonal antibody (M08), clone 2A11

DPT monoclonal antibody (M08), clone 2A11