DPH2 MaxPab mouse polyclonal antibody (B01P)
  • DPH2 MaxPab mouse polyclonal antibody (B01P)

DPH2 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001802-B01P
DPH2 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DPH2 protein.
Información adicional
Size 50 ug
Gene Name DPH2
Gene Alias DPH2L2
Gene Description DPH2 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MESMFSSPAEAALQRETGVPGLLTPLPDLDGVYELERVAGFVRDLGCERVALQFPDQLLGDAVAVAARLEETTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRLLLGWAPGQPFSSCCPDTG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DPH2 (NP_001375.2, 1 a.a. ~ 489 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1802

Enviar uma mensagem


DPH2 MaxPab mouse polyclonal antibody (B01P)

DPH2 MaxPab mouse polyclonal antibody (B01P)