DPH1 monoclonal antibody (M02), clone 2C5
  • DPH1 monoclonal antibody (M02), clone 2C5

DPH1 monoclonal antibody (M02), clone 2C5

Ref: AB-H00001801-M02
DPH1 monoclonal antibody (M02), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPH1.
Información adicional
Size 100 ug
Gene Name DPH1
Gene Alias DPH2L|DPH2L1|FLJ33211|OVCA1
Gene Description DPH1 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA,IF
Immunogen Prot. Seq ILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFVRLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPH1 (NP_001374, 216 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1801
Clone Number 2C5
Iso type IgG2b Kappa

Enviar uma mensagem


DPH1 monoclonal antibody (M02), clone 2C5

DPH1 monoclonal antibody (M02), clone 2C5