View larger
Rabbit polyclonal antibody raised against a full-length human DOK1 protein.
AB-H00001796-D01
New product
DOK1 MaxPab rabbit polyclonal antibody (D01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | DOK1 |
| Gene Alias | MGC117395|MGC138860|P62DOK |
| Gene Description | docking protein 1, 62kDa (downstream of tyrosine kinase 1) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | DOK1 (NP_001372.1, 1 a.a. ~ 481 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 1796 |
More info
Rabbit polyclonal antibody raised against a full-length human DOK1 protein.