DOK1 MaxPab mouse polyclonal antibody (B01)
  • DOK1 MaxPab mouse polyclonal antibody (B01)

DOK1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00001796-B01
DOK1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human DOK1 protein.
Información adicional
Size 50 uL
Gene Name DOK1
Gene Alias MGC117395|MGC138860|P62DOK
Gene Description docking protein 1, 62kDa (downstream of tyrosine kinase 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DOK1 (NP_001372.1, 1 a.a. ~ 481 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1796

Enviar uma mensagem


DOK1 MaxPab mouse polyclonal antibody (B01)

DOK1 MaxPab mouse polyclonal antibody (B01)