DNTT monoclonal antibody (M01), clone 4H5
  • DNTT monoclonal antibody (M01), clone 4H5

DNTT monoclonal antibody (M01), clone 4H5

Ref: AB-H00001791-M01
DNTT monoclonal antibody (M01), clone 4H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DNTT.
Información adicional
Size 100 ug
Gene Name DNTT
Gene Alias TDT
Gene Description deoxynucleotidyltransferase, terminal
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNTT (AAH12920, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1791
Clone Number 4H5
Iso type IgG1 Kappa

Enviar uma mensagem


DNTT monoclonal antibody (M01), clone 4H5

DNTT monoclonal antibody (M01), clone 4H5