DNMT1 monoclonal antibody (M01A), clone 2B5
  • DNMT1 monoclonal antibody (M01A), clone 2B5

DNMT1 monoclonal antibody (M01A), clone 2B5

Ref: AB-H00001786-M01A
DNMT1 monoclonal antibody (M01A), clone 2B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DNMT1.
Información adicional
Size 200 uL
Gene Name DNMT1
Gene Alias AIM|CXXC9|DNMT|FLJ16293|MCMT|MGC104992
Gene Description DNA (cytosine-5-)-methyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNMT1 (NP_001370, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1786
Clone Number 2B5
Iso type IgG1 Kappa

Enviar uma mensagem


DNMT1 monoclonal antibody (M01A), clone 2B5

DNMT1 monoclonal antibody (M01A), clone 2B5