DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)
  • DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)

DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001778-D01P
DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DYNC1H1 protein.
Información adicional
Size 100 ug
Gene Name DYNC1H1
Gene Alias DHC1|DHC1a|DKFZp686P2245|DNCH1|DNCL|DNECL|DYHC|Dnchc1|HL-3|KIAA0325|p22
Gene Description dynein, cytoplasmic 1, heavy chain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DYNC1H1 (AAH64521.1, 1 a.a. ~ 197 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1778

Enviar uma mensagem


DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)

DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)