DNCH1 polyclonal antibody (A01)
  • DNCH1 polyclonal antibody (A01)

DNCH1 polyclonal antibody (A01)

Ref: AB-H00001778-A01
DNCH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DNCH1.
Información adicional
Size 50 uL
Gene Name DYNC1H1
Gene Alias DHC1|DHC1a|DKFZp686P2245|DNCH1|DNCL|DNECL|DYHC|Dnchc1|HL-3|KIAA0325|p22
Gene Description dynein, cytoplasmic 1, heavy chain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TSQGATLDACSFGVTGLKLQGATCNNNKLSLSNAISTALPLTQLRWVKQTNTEKKASVVTLPVYLNFTRADLIFTVDFEIATKEDPRSFYERGVAVLCTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNCH1 (AAH21297, 733 a.a. ~ 832 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1778

Enviar uma mensagem


DNCH1 polyclonal antibody (A01)

DNCH1 polyclonal antibody (A01)