DMRT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • DMRT1 purified MaxPab rabbit polyclonal antibody (D01P)

DMRT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001761-D01P
DMRT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DMRT1 protein.
Información adicional
Size 100 ug
Gene Name DMRT1
Gene Alias DMT1
Gene Description doublesex and mab-3 related transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DMRT1 (NP_068770.2, 1 a.a. ~ 373 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1761

Enviar uma mensagem


DMRT1 purified MaxPab rabbit polyclonal antibody (D01P)

DMRT1 purified MaxPab rabbit polyclonal antibody (D01P)