DLX5 monoclonal antibody (M09), clone 4C6
  • DLX5 monoclonal antibody (M09), clone 4C6

DLX5 monoclonal antibody (M09), clone 4C6

Ref: AB-H00001749-M09
DLX5 monoclonal antibody (M09), clone 4C6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant DLX5.
Información adicional
Size 100 ug
Gene Name DLX5
Gene Alias -
Gene Description distal-less homeobox 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1749
Clone Number 4C6
Iso type IgG2a Kappa

Enviar uma mensagem


DLX5 monoclonal antibody (M09), clone 4C6

DLX5 monoclonal antibody (M09), clone 4C6