DLX4 monoclonal antibody (M01), clone 1F11
  • DLX4 monoclonal antibody (M01), clone 1F11

DLX4 monoclonal antibody (M01), clone 1F11

Ref: AB-H00001748-M01
DLX4 monoclonal antibody (M01), clone 1F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DLX4.
Información adicional
Size 100 ug
Gene Name DLX4
Gene Alias BP1|DLX7|DLX8|DLX9
Gene Description distal-less homeobox 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX4 (AAH16145, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1748
Clone Number 1F11
Iso type IgG2a Kappa

Enviar uma mensagem


DLX4 monoclonal antibody (M01), clone 1F11

DLX4 monoclonal antibody (M01), clone 1F11