DLX2 monoclonal antibody (M08), clone 3G6
  • DLX2 monoclonal antibody (M08), clone 3G6

DLX2 monoclonal antibody (M08), clone 3G6

Ref: AB-H00001746-M08
DLX2 monoclonal antibody (M08), clone 3G6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant DLX2.
Información adicional
Size 100 ug
Gene Name DLX2
Gene Alias TES-1|TES1
Gene Description distal-less homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLX2 (NP_004396, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1746
Clone Number 3G6
Iso type IgG2b Kappa

Enviar uma mensagem


DLX2 monoclonal antibody (M08), clone 3G6

DLX2 monoclonal antibody (M08), clone 3G6