DLST monoclonal antibody (M01), clone 4D7
  • DLST monoclonal antibody (M01), clone 4D7

DLST monoclonal antibody (M01), clone 4D7

Ref: AB-H00001743-M01
DLST monoclonal antibody (M01), clone 4D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DLST.
Información adicional
Size 100 ug
Gene Name DLST
Gene Alias DLTS
Gene Description dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLST (NP_001924, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1743
Clone Number 4D7
Iso type IgG2b Kappa

Enviar uma mensagem


DLST monoclonal antibody (M01), clone 4D7

DLST monoclonal antibody (M01), clone 4D7