DLST MaxPab rabbit polyclonal antibody (D01)
  • DLST MaxPab rabbit polyclonal antibody (D01)

DLST MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001743-D01
DLST MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DLST protein.
Información adicional
Size 100 uL
Gene Name DLST
Gene Alias DLTS
Gene Description dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEID
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLST (NP_001924.2, 1 a.a. ~ 453 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1743

Enviar uma mensagem


DLST MaxPab rabbit polyclonal antibody (D01)

DLST MaxPab rabbit polyclonal antibody (D01)