DLST polyclonal antibody (A01)
  • DLST polyclonal antibody (A01)

DLST polyclonal antibody (A01)

Ref: AB-H00001743-A01
DLST polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DLST.
Información adicional
Size 50 uL
Gene Name DLST
Gene Alias DLTS
Gene Description dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLST (NP_001924, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1743

Enviar uma mensagem


DLST polyclonal antibody (A01)

DLST polyclonal antibody (A01)