DKC1 purified MaxPab mouse polyclonal antibody (B01P)
  • DKC1 purified MaxPab mouse polyclonal antibody (B01P)

DKC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001736-B01P
DKC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DKC1 protein.
Información adicional
Size 50 ug
Gene Name DKC1
Gene Alias CBF5|DKC|FLJ97620|NAP57|NOLA4|XAP101
Gene Description dyskeratosis congenita 1, dyskerin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IHC-P,IF
Immunogen Prot. Seq MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DKC1 (NP_001354, 1 a.a. ~ 514 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1736

Enviar uma mensagem


DKC1 purified MaxPab mouse polyclonal antibody (B01P)

DKC1 purified MaxPab mouse polyclonal antibody (B01P)