DIO1 monoclonal antibody (M01), clone 1E4
  • DIO1 monoclonal antibody (M01), clone 1E4

DIO1 monoclonal antibody (M01), clone 1E4

Ref: AB-H00001733-M01
DIO1 monoclonal antibody (M01), clone 1E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DIO1.
Información adicional
Size 100 ug
Gene Name DIO1
Gene Alias 5DI|MGC130050|MGC130051|TXDI1
Gene Description deiodinase, iodothyronine, type I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DIO1 (NP_000783.2, 35 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1733
Clone Number 1E4
Iso type IgG2a Kappa

Enviar uma mensagem


DIO1 monoclonal antibody (M01), clone 1E4

DIO1 monoclonal antibody (M01), clone 1E4