SEPT1 purified MaxPab mouse polyclonal antibody (B02P)
  • SEPT1 purified MaxPab mouse polyclonal antibody (B02P)

SEPT1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00001731-B02P
SEPT1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SEPT1 protein.
Información adicional
Size 50 ug
Gene Name SEPT1
Gene Alias DIFF6|LARP|MGC20394|PNUTL3|SEP1
Gene Description septin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEPT1 (NP_443070.1, 1 a.a. ~ 367 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1731

Enviar uma mensagem


SEPT1 purified MaxPab mouse polyclonal antibody (B02P)

SEPT1 purified MaxPab mouse polyclonal antibody (B02P)