DIAPH1 polyclonal antibody (A01)
  • DIAPH1 polyclonal antibody (A01)

DIAPH1 polyclonal antibody (A01)

Ref: AB-H00001729-A01
DIAPH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DIAPH1.
Información adicional
Size 50 uL
Gene Name DIAPH1
Gene Alias DFNA1|DIA1|DRF1|FLJ25265|LFHL1|hDIA1
Gene Description diaphanous homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DIAPH1 (NP_005210, 921 a.a. ~ 1024 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1729

Enviar uma mensagem


DIAPH1 polyclonal antibody (A01)

DIAPH1 polyclonal antibody (A01)