CYB5R3 monoclonal antibody (M01), clone 2A9
  • CYB5R3 monoclonal antibody (M01), clone 2A9

CYB5R3 monoclonal antibody (M01), clone 2A9

Ref: AB-H00001727-M01
CYB5R3 monoclonal antibody (M01), clone 2A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYB5R3.
Información adicional
Size 100 ug
Gene Name CYB5R3
Gene Alias B5R|DIA1
Gene Description cytochrome b5 reductase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYB5R3 (AAH04821.1, 157 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1727
Clone Number 2A9
Iso type IgG2a Kappa

Enviar uma mensagem


CYB5R3 monoclonal antibody (M01), clone 2A9

CYB5R3 monoclonal antibody (M01), clone 2A9