CYB5R3 purified MaxPab mouse polyclonal antibody (B01P)
  • CYB5R3 purified MaxPab mouse polyclonal antibody (B01P)

CYB5R3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001727-B01P
CYB5R3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CYB5R3 protein.
Información adicional
Size 50 ug
Gene Name CYB5R3
Gene Alias B5R|DIA1
Gene Description cytochrome b5 reductase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYB5R3 (NP_000389.1, 1 a.a. ~ 301 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1727

Enviar uma mensagem


CYB5R3 purified MaxPab mouse polyclonal antibody (B01P)

CYB5R3 purified MaxPab mouse polyclonal antibody (B01P)