CYB5R3 polyclonal antibody (A01)
  • CYB5R3 polyclonal antibody (A01)

CYB5R3 polyclonal antibody (A01)

Ref: AB-H00001727-A01
CYB5R3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CYB5R3.
Información adicional
Size 50 uL
Gene Name CYB5R3
Gene Alias B5R|DIA1
Gene Description cytochrome b5 reductase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYB5R3 (AAH04821, 1 a.a. ~ 301 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1727

Enviar uma mensagem


CYB5R3 polyclonal antibody (A01)

CYB5R3 polyclonal antibody (A01)