DHFR monoclonal antibody (M01), clone 2B10
  • DHFR monoclonal antibody (M01), clone 2B10

DHFR monoclonal antibody (M01), clone 2B10

Ref: AB-H00001719-M01
DHFR monoclonal antibody (M01), clone 2B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DHFR.
Información adicional
Size 100 ug
Gene Name DHFR
Gene Alias -
Gene Description dihydrofolate reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1719
Clone Number 2B10
Iso type IgG2a Kappa

Enviar uma mensagem


DHFR monoclonal antibody (M01), clone 2B10

DHFR monoclonal antibody (M01), clone 2B10