DHCR7 purified MaxPab rabbit polyclonal antibody (D01P)
  • DHCR7 purified MaxPab rabbit polyclonal antibody (D01P)

DHCR7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001717-D01P
DHCR7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DHCR7 protein.
Información adicional
Size 100 ug
Gene Name DHCR7
Gene Alias SLOS
Gene Description 7-dehydrocholesterol reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce
Immunogen Prot. Seq MAAKLQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMACDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHKFLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPLLWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFNGRPGIVAWTLINLSF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DHCR7 (NP_001351.1, 1 a.a. ~ 475 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1717

Enviar uma mensagem


DHCR7 purified MaxPab rabbit polyclonal antibody (D01P)

DHCR7 purified MaxPab rabbit polyclonal antibody (D01P)