TIMM8A monoclonal antibody (M04), clone 1A12
  • TIMM8A monoclonal antibody (M04), clone 1A12

TIMM8A monoclonal antibody (M04), clone 1A12

Ref: AB-H00001678-M04
TIMM8A monoclonal antibody (M04), clone 1A12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TIMM8A.
Información adicional
Size 100 ug
Gene Name TIMM8A
Gene Alias DDP|DDP1|DFN1|MGC12262|MTS
Gene Description translocase of inner mitochondrial membrane 8 homolog A (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLLNDKWVNEEIKKKIEKCLETNDNGNTTYQNLWDTAKAVVRGKFIAISTYIKKEEKLQINNLTMNLIELEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIMM8A (AAH05236, 1 a.a. ~ 72 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1678
Clone Number 1A12
Iso type IgG2a Kappa

Enviar uma mensagem


TIMM8A monoclonal antibody (M04), clone 1A12

TIMM8A monoclonal antibody (M04), clone 1A12