DFFA MaxPab rabbit polyclonal antibody (D01)
  • DFFA MaxPab rabbit polyclonal antibody (D01)

DFFA MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001676-D01
DFFA MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DFFA protein.
Información adicional
Size 100 uL
Gene Name DFFA
Gene Alias DFF-45|DFF1|ICAD
Gene Description DNA fragmentation factor, 45kDa, alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DFFA (NP_004392.1, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1676

Enviar uma mensagem


DFFA MaxPab rabbit polyclonal antibody (D01)

DFFA MaxPab rabbit polyclonal antibody (D01)