DFFA purified MaxPab mouse polyclonal antibody (B01P)
  • DFFA purified MaxPab mouse polyclonal antibody (B01P)

DFFA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001676-B01P
DFFA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DFFA protein.
Información adicional
Size 50 ug
Gene Name DFFA
Gene Alias DFF-45|DFF1|ICAD
Gene Description DNA fragmentation factor, 45kDa, alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DFFA (NP_004392.1, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1676

Enviar uma mensagem


DFFA purified MaxPab mouse polyclonal antibody (B01P)

DFFA purified MaxPab mouse polyclonal antibody (B01P)